• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> 14-3-3 zeta/delta Antibody / YWHAZ

14-3-3 zeta/delta Antibody / YWHAZ (RQ4280)

  Catalog No Formulation Size Price (USD)  
Image RQ4280 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 389
Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) A549, 5) PANC-1, 6) SK-OV-3 and 7) 22RV1 lysate with 14-3-3 zeta antibody at 0.5ug/ml. Predicted molecular weight ~28 kDa.
Western blot testing of rat 1) brain, 2) spleen, 3) lung, 4) liver and mouse 5) brain, 6) spleen, 7) lung, 8) liver and 9) kidney lysate with 14-3-3 zeta antibody at 0.5ug/ml. Predicted molecular weight ~28 kDa.
IHC testing of FFPE human lung cancer tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE human breast cancer tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE rat kidney tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE rat small intestine tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IF/ICC staining of FFPE human A549 cells with 14-3-3 zeta antibody (green) at 2ug/ml and DAPI nuclear stain (blue). Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IF/ICC staining of FFPE human A431 cells with 14-3-3 zeta antibody (green) at 2ug/ml and DAPI nuclear stain (blue). Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE mouse small intestine tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
Flow cytometry testing of human A431 cells with 14-3-3 zeta antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= 14-3-3 zeta antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P63104
Localization Cytoplasm, nucleus
Applications Western blot : 0.5-1ug/ml
Immunofluorescence/Immunocytochemistry (FFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/10^6 cells
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This 14-3-3 zeta antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products


14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

Application Notes

Optimal dilution of the 14-3-3 zeta antibody should be determined by the researcher.


Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ were used as the immunogen for the 14-3-3 zeta antibody.


After reconstitution, the 14-3-3 zeta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.