- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
UNC5C Antibody (R31843)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R31843 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | O95185 |
| Applications | Western blot : 0.1-0.5ug/ml Flow cytometry : 1-3ug/million cells |
| Limitations | This UNC5C antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Optimal dilution of the UNC5C antibody should be determined by the researcher.
Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody.
After reconstitution, the UNC5C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
