- Tel: 858.663.9055
- Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
SUMO-conjugating enzyme UBC9 (UBE2I), also called UBC9, is a protein that in humans is encoded by the UBE2I gene. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. It is mapped to 16p13.3. UBC9 could fully complement the mutant phenotype of a yeast ubc9 mutant strain. This gene may play a similar role via interaction with WT1, which is able to impose a block to cell cycle progression in eukaryotic cells. What�s more, it could support the growth of yeast ubc9 temperature-sensitive mutants at nonpermissive temperatures, indicating that the gene is a functional homolog of yeast ubc9. UBC9 is specifically associated with FHIT, such as FHIT may be involved in cell cycle control through its interaction with UBC9.
Optimal dilution of the UBC9 antibody should be determined by the researcher.
Amino acids NIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS were used as the immunogen for the UBC9 antibody.
After reconstitution, the UBC9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.