- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
TrkA Antibody (RQ4398)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
RQ4398 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity purified |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| UniProt | P04629 |
| Applications | Western blot : 0.5-1ug/ml |
| Limitations | This TrkA antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Neurotrophic tyrosine kinase receptor type 1, also called Trk-A, is a protein that in humans is encoded by the NTRK1 gene. The NTKR1 gene encodes the neurotrophic tyrosine kinase-1 receptor and belongs to a family of nerve growth factor receptors whose ligands include neurotrophins. This gene is mapped to 1q23.1. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer.
Optimal dilution of the TrkA antibody should be determined by the researcher.
Amino acids EVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL from the human protein were used as the immunogen for the TrkA antibody.
After reconstitution, the TrkA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
