• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> TPR Antibody / Translocated promoter region protein

TPR Antibody / Translocated promoter region protein (RQ7045)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ7045 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Immunofluorescent staining of FFPE human Caco-2 cells with TPR antibody. HIER: steam section in pH6 citrate buffer for 20 min.
›
Immunofluorescent staining of FFPE human Caco-2 cells with TPR antibody. HIER: steam section in pH6 citrate buffer for 20 min.
Immunofluorescent staining of FFPE human SiHa cells with TPR antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human colorectal cancer tissue with TPR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain tissue with TPR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain tissue with TPR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) K562, 2) HL60, 3) HEL, 4) HeLa, 5) U-251 and 6) SiHa cell lysate with TPR antibody. Predicted molecular weight ~267 kDa.
Flow cytometry testing of human Jurkat cells with TPR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TPR antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P12270
Localization Cytoplasmic, nuclear
Applications Western blot : 0.5-1 ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence : 5ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This TPR antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

The tetratricopeptide repeat (TPR) is a structural motif. This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias.

Application Notes

Optimal dilution of the TPR antibody should be determined by the researcher.

Immunogen

Amino acids AAVLQQVLERTELNKLPKSVQNKLEKFLADQQ were used as the immunogen for the TPR antibody.

Storage

After reconstitution, the TPR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all TPR antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.