• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> TORC2 Antibody / CRTC2

TORC2 Antibody / CRTC2 (RQ4279)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4279 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) MCF7 and 3) A375 cell lysate with TORC2 antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.
Western blot testing of human 1) HeLa, 2) MCF7 and 3) A375 cell lysate with TORC2 antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q53ET0
Localization Cytoplasm
Applications Western blot : 0.5-1ug/ml
Limitations This TORC2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Dog, Pig, Cow
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Dog, Pig, Cow
  • Applications : WB, ELISA (peptide)
    Reactivity : Mouse, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Pig, Cow
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Dog

Description

TORC2 (Transducer of CREB protein 2), also known as CRTC2, is a protein which in humans is encoded by the CRTC2 gene. This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5.

Application Notes

Optimal dilution of the TORC2 antibody should be determined by the researcher.

Immunogen

Amino acids EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR were used as the immunogen for the TORC2 antibody.

Storage

After reconstitution, the TORC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all TORC2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.