• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> TIMP3 Antibody

TIMP3 Antibody (R32715)

  Catalog No Formulation Size Price (USD)  
Image R32715 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat kidney and 2) mouse NIH3T3 lysate with TIMP3 antibody at 0.5ug/ml. Predicted molecular weight ~24 kDa (unmodified) and ~33 kDa (glycosylated).
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P35625
Applications Western Blot : 0.5-1ug/ml
ELISA : 0.1-0.5ug/ml (human protein tested; request BSA-free format for coating)
Limitations This TIMP3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : FACS, IF, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA (protein)
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA (protein)
    Reactivity : Human, Mouse, Rat
  • Applications : FACS, IHC-P, WB
    Reactivity : Human, Mouse

Description

Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Application Notes

Optimal dilution of the TIMP3 antibody should be determined by the researcher.

Immunogen

Amino acids 107-141 (RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL) from the human protein were used as the immunogen for the TIMP3 antibody.

Storage

After reconstitution, the TIMP3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.