• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> TFPI2 Antibody / Tissue factor pathway inhibitor 2

TFPI2 Antibody / Tissue factor pathway inhibitor 2 (R32729)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32729 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) mouse spleen, 2) human HeLa, 3) human placenta and 4) human MCF7 lysate with TFPI2 antibody at 0.5ug/ml. Expected molecular weight: ~27 kDa (unmodified), 30-35 kDa (glycosylated).
›
Western blot testing of 1) mouse spleen, 2) human HeLa, 3) human placenta and 4) human MCF7 lysate with TFPI2 antibody at 0.5ug/ml. Expected molecular weight: ~27 kDa (unmodified), 30-35 kDa (glycosylated).
IHC testing of FFPE human placental tissue with TFPI2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Flow cytometry testing of human A549 cells with TFPI2 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TFPI2 antibody.
Flow cytometry testing of human U-87 MG cells with TFPI2 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TFPI2 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P48307
Localization Cytoplasmic
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This TFPI2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney.

Application Notes

Optimal dilution of the TFPI2 antibody should be determined by the researcher.

Immunogen

Amino acids 70-105 (EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ) from the human protein were used as the immunogen for the TFPI2 antibody.

Storage

After reconstitution, the TFPI2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all TFPI2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.