• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Tec Antibody

Tec Antibody (RQ4064)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4064 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) MCF7, 3) COLO320, 4) HepG2, 5) rat stomach, 6) mouse stomach and 7) mouse heart lysate with Tec antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.
Western blot testing of human 1) HeLa, 2) MCF7, 3) COLO320, 4) HepG2, 5) rat stomach, 6) mouse stomach and 7) mouse heart lysate with Tec antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P42680
Applications Western Blot : 0.5-1ug/ml
Limitations This Tec antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Rat
  • Applications : IF, WB, IHC-P
    Reactivity : Human, Mouse

Description

TEC (TEC Protein Tyrosine Kinase) is an enzyme that in humans is encoded by the TEC gene. The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. By fluorescence in situ hybridization, Sato et al. (1994) mapped the gene to 4p12, the same location reported for TXK. Mouse Tec is a non-receptor type protein-tyrosine kinase that is highly expressed in many hematopoietic cell lines. Hantschel et al. (2007) identified TEC kinase and BTK kinase as major binders of the tyrosine kinase inhibitor dasatinib, which is used for treatment of BCR/ABL-positive CML.

Application Notes

Optimal dilution of the Tec antibody should be determined by the researcher.

Immunogen

Amino acids HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK from the human protein were used as the immunogen for the Tec antibody.

Storage

After reconstitution, the Tec antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Tec antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.