• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Sucrase Isomaltase Antibody / SI

Sucrase Isomaltase Antibody / SI (RQ4659)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4659 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) COLO-320, 3) SHG-44 and 4) HEK293 lysate with Sucrase Isomaltase antibody at 0.5ug/ml. Predicted molecular weight ~209 kDa.
›
Western blot testing of human 1) HeLa, 2) COLO-320, 3) SHG-44 and 4) HEK293 lysate with Sucrase Isomaltase antibody at 0.5ug/ml. Predicted molecular weight ~209 kDa.
IHC staining of FFPE mouse intestine with Sucrase Isomaltase antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat intestine with Sucrase Isomaltase antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat intestine with Sucrase Isomaltase antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of rat intestine lysate with Sucrase Isomaltase antibody. Predicted molecular weight ~209 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P14410
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This Sucrase Isomaltase antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.

Application Notes

Optimal dilution of the Sucrase Isomaltase antibody should be determined by the researcher.

Immunogen

Amino acids FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID were used as the immunogen for the Sucrase Isomaltase antibody.

Storage

After reconstitution, the Sucrase Isomaltase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Sucrase Isomaltase antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.