• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> SAPK4 Antibody

SAPK4 Antibody (R31807)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31807 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat kidney, 2) human HeLa, and 3) human A549 lysate with SAPK4 antibody. Expected/observed molecular weight ~42 kDa.
›
Western blot testing of 1) rat kidney, 2) human HeLa, and 3) human A549 lysate with SAPK4 antibody. Expected/observed molecular weight ~42 kDa.
IHC testing of FFPE human intestinal cancer with SAPK4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with SAPK4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with SAPK4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O15264
Localization Nuclear, cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This SAPK4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse, Rat

Description

MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4 (SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.

Application Notes

Optimal dilution of the SAPK4 antibody should be determined by the researcher.

Immunogen

Amino acids KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL of human MAPK13/SAPK4 were used as the immunogen for the SAPK4 antibody.

Storage

After reconstitution, the SAPK4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all SAPK4 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.