RKIP Antibody PEBP1 | RQ4378 NSJ Bioreagents

	Catalog No	Formulation	Size	Price (USD)
	RQ4378	0.5mg/ml if reconstituted with 0.2ml sterile DI water	100 ug	429
Formulation

›

Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) MCF7, 5) mouse testis and 6) mouse brain lysate with RKIP antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.

IHC testing of FFPE human pancreatic cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

IHC testing of FFPE human liver cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

IHC testing of FFPE human intestinal cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

IHC testing of FFPE human endometrial carcinoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

IHC testing of FFPE human sarcoma with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

IHC testing of FFPE human breast cancer with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

IHC testing of FFPE human tonsil with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

IHC testing of FFPE mouse kidney with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

IHC testing of FFPE mouse brain with RKIP antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Flow cytometry testing of human HepG2 cells with RKIP antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RKIP antibody.

Western blot testing of human 1) HeLa, 2) MCF7, 3) HepG2, 4) 293T and 5) mouse testis lysate with RKIP antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.

Availability	1-3 business days
Species Reactivity	Human, Mouse
Format	Antigen affinity purified
Clonality	Polyclonal (rabbit origin)
Isotype	Rabbit IgG
Purity	Antigen affinity purified
Buffer	Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt	P30086
Localization	Cytoplasm
Applications	Western blot : 0.5-1ug/ml Immunohistochemistry (FFPE) : 1-2ug/ml Flow cytometry : 1-3ug/million cells
Limitations	This RKIP antibody is available for research use only.
	Review this product on BioCompare and get a $20 Amazon gift card

Description

PEBP1 (Phosphatidylethanolamine-binding protein 1), also called PBP, RKIP, inhibits the phosphorylation and activation of MEK by RAF1. PEBP1 is identical to the phosphatidylethanolamine-binding protein (PBP) with a relative molecular mass of 23 kD. The PEBP1 gene is mapped on 12q24.23. PEBP1 coimmunoprecipitates with RAF1 and MEK from cell lysates and colocalizes with RAF1 when examined by confocal microscopy. PEBP1 overexpression interferes with the activation of MEK and ERK, induction of AP1-dependent reporter genes, and transformation elicited by an oncogenically activated RAF1 kinase. PEBP1 expression was rapidly upregulated during induction of chemotherapy-triggered apoptosis in human prostate and breast cancer cell lines, and maximal RKIP expression correlated perfectly with the onset of apoptosis by Chatterjee et al (2004). RKIP depletion decreased the mitotic index, the number of metaphase cells, traversal times from nuclear envelope breakdown to anaphase, and an override of mitotic checkpoints induced by spindle poisons.

Application Notes

Optimal dilution of the RKIP antibody should be determined by the researcher.

Immunogen

Amino acids DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ were used as the immunogen for the RKIP antibody.

Storage

After reconstitution, the RKIP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

RKIP Antibody / PEBP1 / PBP (RQ4378)

Description

Application Notes

Immunogen

Storage

Area of Research

Product Type

Protocols

Contact Us

NSJ Bioreagents