• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Relaxin Antibody / RLN1

Relaxin Antibody / RLN1 (R32980)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32980 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of rat PC-12 cell lysate with Relaxin antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
›
Western blot testing of rat PC-12 cell lysate with Relaxin antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
IHC testing of FFPE human lung cancer tissue with Relaxin antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human colon cancer tissue with Relaxin antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human prostate cancer tissue with Relaxin antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P04808
Localization Secreted
Applications Western Blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This Relaxin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Relaxin 1 is a member of relaxin-like peptide family. Relaxin gene maps to human chromosome 19 near D19Mit23. Relaxin is a peptide hormone produced by the corpora lutea of ovaries during pregnancy in many mammalian species, including man. Relaxin widens the pubic bone and facilitates labor, it also softens the cervix (cervical ripening), and relaxes the uterine musculature. However, its significance may reach much further. Relaxin affects collagen metabolism, inhibiting collagen synthesis and enhancing its breakdown by increasing matrix metalloproteinases. It also enhances angiogenesis and is a potent renal vasodilator.

Application Notes

Optimal dilution of the Relaxin antibody should be determined by the researcher.

Immunogen

Amino acids VAAKWKDDVIKLCGRELVRAQIAICGMSTWS were used as the immunogen for the Relaxin antibody.

Storage

After reconstitution, the Relaxin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Relaxin 1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.