- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
PML Antibody / Promyelocytic leukemia protein (R32553)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32553 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
| Availability | 1-3 business days |
| Species Reactivity | Mouse |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | Q60953 |
| Localization | Nuclear, cytoplasmic (isoform dependent) |
| Applications | Western blot : 0.5-1ug/ml IHC (FFPE) : 1-2ug/ml |
| Limitations | This PML antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Promyelocytic leukemia protein functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms.
Optimal dilution of the PML antibody should be determined by the researcher.
Amino acids 140-177 (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) from the mouse protein were used as the immunogen for the PML antibody.
After reconstitution, the PML antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
