• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> PMEL17 / Melanoma gp100 Antibody

PMEL17 / Melanoma gp100 Antibody (RQ4546)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4546 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat heart and 2) mouse heart lysate with PMEL17 antibody at 0.5ug/ml. Predicted molecular weight: ~70 kDa (unmodified), ~100 kDa (glycosylated).
Western blot testing of 1) rat heart and 2) mouse heart lysate with PMEL17 antibody at 0.5ug/ml. Predicted molecular weight: ~70 kDa (unmodified), ~100 kDa (glycosylated).
Availability 1-3 business days
Species Reactivity Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P40967
Applications Western blot : 0.5-1ug/ml
Limitations This PMEL17 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

This gene is mapped to 12q13.2. It encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the PMEL17 antibody should be determined by the researcher.

Immunogen

Amino acids KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD were used as the immunogen for the PMEL17 antibody.

Storage

After reconstitution, the PMEL17 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PMEL17 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.