• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Perilipin 3 Antibody

Perilipin 3 Antibody (R32450)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32450 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat liver, 2) mouse kidney and 3) human HeLa lysate with Perilipin 3 antibody at 0.5ug/ml. Predicted molecular weight ~47 kDa.
›
Western blot testing of 1) rat liver, 2) mouse kidney and 3) human HeLa lysate with Perilipin 3 antibody at 0.5ug/ml. Predicted molecular weight ~47 kDa.
IHC testing of FFPE human lung cancer tissue with Perilipin 3 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O60664
Localization Cytoplasmic, membranous
Applications Western blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This Perilipin 3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.

Application Notes

Optimal dilution of the Perilipin 3 antibody should be determined by the researcher.

Immunogen

Amino acids ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQ were used as the immunogen for the Perilipin 3 antibody.

Storage

Prior to reconstitution, store at 4oC. After reconstitution, the Perilipin 3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Perilipin 3 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.