• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> PAR2 Antibody / F2RL1

PAR2 Antibody / F2RL1 (R32144)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32144 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) COLO320, 3) SW620, 4) HepG2 lysate with PAR2 antibody. Expected molecular weight: 33-48 kDa (unmodified), 55-100 kDa (glycosylated). (Ref 1)
Western blot testing of human 1) HeLa, 2) COLO320, 3) SW620, 4) HepG2 lysate with PAR2 antibody. Expected molecular weight: 33-48 kDa (unmodified), 55-100 kDa (glycosylated). (Ref 1)
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P55085
Applications Western blot : 0.1-0.5ug/ml
Limitations This PAR2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Protease activated receptor 2 (PAR2), also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.

Application Notes

Optimal dilution of the PAR2 antibody should be determined by the researcher.

Immunogen

Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody.

Storage

After reconstitution, the PAR2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PAR2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.