- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
PAK5 Antibody / PAK7 (R32341)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32341 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | Q9P286 |
| Localization | Cytoplasmic |
| Applications | Western blot : 0.1-0.5ug/ml IHC (FFPE) : 0.5-1ug/ml |
| Limitations | This PAK5 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Serine/threonine-protein kinase PAK7, also known as PAK5, is an enzyme that in humans is encoded by the PAK7 gene. The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling. This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, and has been shown to bind CDC42 in the presence of GTP. And this kinase is predominantly expressed in brain. It is capable of promoting neurite outgrowth, and thus may play a role in neurite development. In addition, this kinase is associated with microtubule networks and induces microtubule stabilization. The subcellular localization of this kinase is tightly regulated during cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.
Optimal dilution of the PAK5 antibody should be determined by the researcher.
Amino acids DPQEQKFTGLPQQWHSLLADTANRPKPMVD of human PAK7/5 were used as the immunogen for the PAK5 antibody.
After reconstitution, the PAK5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
