• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> NONO Antibody / p54nrb Antibody

NONO Antibody / p54nrb Antibody [clone 11E2-] (RQ4624)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4624 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) placenta, 3) MCF7, 4) A549, 5) SW620, 6) PANC-1, 7) U-2 OS and 8) K562 lysate with NONO antibody at 0.5ug/ml. Predicted molecular weight ~54 kDa.
›
Western blot testing of human 1) HeLa, 2) placenta, 3) MCF7, 4) A549, 5) SW620, 6) PANC-1, 7) U-2 OS and 8) K562 lysate with NONO antibody at 0.5ug/ml. Predicted molecular weight ~54 kDa.
ICC staining of FFPE human A431 cells with NONO antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Flow cytometry testing of human U-2 OS cells with NONO antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NONO antibody.
Availability 1-3 business days
Species Reactivity Human
Format Purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG1
Clone Name 11E2-
Purity Protein G affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q15233
Localization Nuclear
Applications Western blot : 0.5-1ug/ml
ICC (FFPE) : 1-2ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This NONO antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat
  • Applications : WB, IHC, ELISA (peptide)
    Reactivity : Human, Mouse
    Pred. Reactivity : Dog, Rat
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human, Mouse
    Pred. Reactivity : Dog, Rat

Description

Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.

Application Notes

Optimal dilution of the NONO antibody should be determined by the researcher.

Immunogen

Amino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ were used as the immunogen for the NONO antibody.

Storage

After reconstitution, the NONO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all NONO antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.