• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> NANOG Antibody

NANOG Antibody (R32790)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32790 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat ovary, 2) mouse ovary and 3) human MCF7 cell lysate with NANOG antibody at 0.5ug/ml. Predicted molecular weight: 35-45 kDa.
›
Western blot testing of 1) rat ovary, 2) mouse ovary and 3) human MCF7 cell lysate with NANOG antibody at 0.5ug/ml. Predicted molecular weight: 35-45 kDa.
Flow cytometry testing of human A549 cells with NANOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NANOG antibody.
Flow cytometry testing of human PC-3 cells with NANOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NANOG antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q9H9S0
Applications Western blot : 0.5-1ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This NANOG antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC, ELISA
    Reactivity : Human
  • Applications : WB, IF, IHC, FACS, ELISA
    Reactivity : Human
    Pred. Reactivity : Primate
  • Applications : IF, FACS, IHC, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Primate
  • Applications : WB, IF, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : DB, ELISA
    Reactivity : Human
  • Applications : IF, DB, ELISA
    Reactivity : Human
    Pred. Reactivity : Primate
  • Applications : WB, ELISA (peptide)
    Reactivity : Mouse
  • Applications : WB, IHC, ELISA (peptide), EIA
    Reactivity : Human
  • Applications : WB, IHC, IF, ELISA (peptide), EIA
    Reactivity : Human
    Pred. Reactivity : Dog, Pig

Description

NANOG is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. It is mapped to 12p13.31. NANOG is thought to be a key factor in maintaining pluripotency. Moreover, NANOG is also thought to function in concert with other factors such as POU5F1 (Oct-4) and SOX2 to establish ESC identity. The NANOG protein has been found to be a transcriptional activator for the Rex1 promoter, playing a key role in sustaining Rex1 expression. Knockdown of NANOG in embryonic stem cells results in a reduction of Rex1 expression, while forced expression of NANOG stimulates Rex1 expression.

Application Notes

Optimal dilution of the NANOG antibody should be determined by the researcher.

Immunogen

Amino acids 115-155 (QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK) from the human protein were used as the immunogen for the NANOG antibody.

Storage

After reconstitution, the NANOG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Nanog antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.