• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> MOG Antibody / Myelin Oligodendrocyte Glycoprotein

MOG Antibody / Myelin Oligodendrocyte Glycoprotein (RQ4651)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4651 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat brain and 2) mouse brain lysate with MOG antibody at 0.5ug/ml. Expected molecular weight: 15-28 kDa depending on glycosylation level.
›
Western blot testing of 1) rat brain and 2) mouse brain lysate with MOG antibody at 0.5ug/ml. Expected molecular weight: 15-28 kDa depending on glycosylation level.
IHC staining of FFPE human glioma with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse brain with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat brain with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat brain with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Flow cytometry testing of human U251 cells with MOG antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MOG antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q16653
Localization Plasma membrane
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This MOG antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS). In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary adhesion molecule to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Application Notes

Optimal dilution of the MOG antibody should be determined by the researcher.

Immunogen

Amino acids RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK were used as the immunogen for the MOG antibody.

Storage

After reconstitution, the MOG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all MOG antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.