• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> MGA Antibody / MAX gene associated protein

MGA Antibody / MAX gene associated protein (R32278)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32278 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) MCF7 and 3) SW620 cell lysate with MGA antibody. Expected molecular weight ~331 kDa.
Western blot testing of human 1) HeLa, 2) MCF7 and 3) SW620 cell lysate with MGA antibody. Expected molecular weight ~331 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q8IWI9
Applications Western blot : 0.1-0.5ug/ml
Limitations This MGA antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Mga is a DNA-binding protein that activates the expression of several important virulence genes in Streptococcus pyogenes (group A Streptococcus, GAS) in response to changing environmental conditions. It had been found that the mouse transcription factor Max interacted with Mga. Coimmunoprecipitation analysis confirmed that Max and Mga interacted in transfected HEK293 cells. EMSA revealed that Mga required Max for binding to the E-box sequence CACGTG. The isolated T-box of Mga bound the brachyury T-box-binding site in the absence of Max. Mga repressed transcription of a reporter driven from a T-box-binding site, but coexpression of Mga with Max caused transcriptional activation from the T-box-binding site. Expression of Mga with Max, but not Mga alone, activated transcription from a reporter containing the E-box site.

Application Notes

Optimal dilution of the MGA antibody should be determined by the researcher.

Immunogen

Amino acids QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH of human MGA were used as the immunogen for the MGA antibody.

Storage

After reconstitution, the MGA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all MGA antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.