• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Lysozyme Antibody / LYZ

Lysozyme Antibody / LYZ (R32157)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32157 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat intestine, 2) rat kidney, 3) rat liver, and human 4) HeLa, 5) SW620, 6) 293 and 7) HepG2 lysate with Lysozyme antibody. Expected/observed molecular weight ~17 kDa.
›
Western blot testing of 1) rat intestine, 2) rat kidney, 3) rat liver, and human 4) HeLa, 5) SW620, 6) 293 and 7) HepG2 lysate with Lysozyme antibody. Expected/observed molecular weight ~17 kDa.
IHC testing of FFPE human intestinal cancer with Lysozyme antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of FFPE human colon with Lysozyme antibody (red) and DAPI (blue). HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of FFPE human ileum with Lysozyme antibody (red) and DAPI (blue). HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of FFPE mouse ileum with Lysozyme antibody (red) and DAPI (blue). HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of FFPE mouse ileum with Lysozyme antibody (red) and DAPI (blue). HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P61626
Localization Cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Immunofluorescence : 5-7ug/ml
Limitations This Lysozyme antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme c, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.

Application Notes

Optimal dilution of the Lysozyme antibody should be determined by the researcher.

Immunogen

Amino acids NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ of human LYZ were used as the immunogen for the Lysozyme antibody.

Storage

After reconstitution, the Lysozyme antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Lysozyme antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.