• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Ku70 Antibody / XRCC6

Ku70 Antibody / XRCC6 (R31952)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31952 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Western blot testing of human 1) A549, 2) HeLa, 3) HePG2 and 4) MCF7 lysate with Ku70 antibody. Predicted/observed molecular weight ~70 kDa.
›
Western blot testing of human 1) A549, 2) HeLa, 3) HePG2 and 4) MCF7 lysate with Ku70 antibody. Predicted/observed molecular weight ~70 kDa.
IHC testing of FFPE human tonsil with Ku70 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human SiHa cells with Ku70 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Ku70 antibody.
Immunofluorescent staining of FFPE human U-2 OS cells with Ku70 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P12956
Localization Nuclear
Applications Western blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Flow cytometry : 1-3ug/million cells
Immunofluorescence : 2-4ug/ml
Limitations This Ku70 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC-P, WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human
  • Applications : WB, IHC-P, ICC, IF, FACS
    Reactivity : Human
  • Applications : WB, IHC, FACS, ELISA
    Reactivity : Human, Mouse
  • Applications : WB, IHC, FACS, IF, ELISA
    Reactivity : Human
  • Applications : IHC, FACS, IF, WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA (peptide)
    Reactivity : Human

Description

XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

Application Notes

Optimal dilution of the Ku70 antibody should be determined by the researcher.

Immunogen

Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody.

Storage

After reconstitution, the Ku70 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Ku70 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.