• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> KCNH1 Antibody / EAG1 (C-Terminal Region)

KCNH1 Antibody / EAG1 (C-Terminal Region) (RQ4065)

  Catalog No Formulation Size Price (USD)  
Image RQ4065 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) COLO-320, 2) HepG2 and 3) A549 lysate with KCNH1 antibody at 0.5ug/ml. Predicted molecular weight ~111 kDa (may be observed larger than predicted due to glycosylation).
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O95259
Applications Western Blot : 0.5-1ug/ml
Limitations This KCNH1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
  • Applications : WB, IF, FACS, Direct ELISA
    Reactivity : Human, Mouse, Rat
  • Applications : WB
    Reactivity : Human, Rat

Description

Potassium voltage-gated channel subfamily H member 1 is a protein that in humans is encoded by the KCNH1 gene. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.

Application Notes

Optimal dilution of the KCNH1 antibody should be determined by the researcher.

Immunogen

Amino acids AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA from the human protein were used as the immunogen for the KCNH1 antibody.

Storage

After reconstitution, the KCNH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.