• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> JUND Antibody

JUND Antibody (RQ4433)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4433 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) placenta and 2) Jurkat lysate with JUND antibody at 0.5ug/ml. Predicted molecular weight: ~39 kDa (JUND-L), 34 kDa (JUND-S).
›
Western blot testing of human 1) placenta and 2) Jurkat lysate with JUND antibody at 0.5ug/ml. Predicted molecular weight: ~39 kDa (JUND-L), 34 kDa (JUND-S). (1)
Western blot testing of 1) rat spleen, 2) rat lung, 3) rat testis, 4) mouse spleen, 5) mouse lung and 6) mouse testis lysate with JUND antibody at 0.5ug/ml. Predicted molecular weight: ~39 kDa (JUND-L), 34 kDa (JUND-S). (1)
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P17535
Applications Western blot : 0.5-1ug/ml
Limitations This JUND antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine
  • Applications : WB, ELISA (peptide)
    Reactivity : Human, Mouse, Rat
    Pred. Reactivity : Dog

Description

Transcription factor JunD is a protein that in humans is encoded by the JUND gene. The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms.

Application Notes

Optimal dilution of the JUND antibody should be determined by the researcher.

1, The short form of the protein lacks the N-terminal 43 amino acids.

Immunogen

Amino acids TASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY from the human protein were used as the immunogen for the JUND antibody.

Storage

After reconstitution, the JUND antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all JunD antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.