- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
IFNAR1 Antibody / Interferon alpha receptor 1 (R32689)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32689 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose |
| UniProt | P17181 |
| Applications | Western blot : 0.5-1ug/ml |
| Limitations | This IFNAR1 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.
Optimal dilution of the IFNAR1 antibody should be determined by the researcher.
Amino acids 263-306 (HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR) from the human protein were used as the immunogen for the IFNAR1 antibody.
After reconstitution, the IFNAR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
