- Tel: 858.663.9055
- Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
HSPA1 (Heat Shock 70kDa Protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.
Optimal dilution of the HSP70 antibody should be determined by the researcher.
Amino acids KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR were used as the immunogen for the HSP70 antibody. This sequence is common to HSPA1A and HSPA1B.
After reconstitution, the HSP70 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.