• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> HOXA1 Antibody (C-Terminal Region) [Discontinued]

HOXA1 Antibody (C-Terminal Region) [Discontinued] (R32943)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32943 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Bulk quote request
Western blot testing of human SW620 cell lysate with HOXA1 antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa (isoform 3). This pAb will not detect the ~14 kDa isoform 1 and may weakly detect the ~24 kDa isoform 2.
Western blot testing of human SW620 cell lysate with HOXA1 antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa (isoform 3). This pAb will not detect the ~14 kDa isoform 1 and may weakly detect the ~24 kDa isoform 2.
Availability Discontinued
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P49639
Applications Western Blot : 0.5-1ug/ml
Limitations This HOXA1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

HOXA1 (Homeobox A1), also called Homeobox 1F, is a protein that in humans is encoded by the HOXA1 gene. In PA-1 teratocarcinoma cells, HOXA1 was induced by retinoic acid earlier than other HOXA cluster genes. The HOXA1 gene is mapped on 7p15.2. In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. A common polymorphism in the HOXA1 gene is associated with a susceptibility to autism spectrum disorder. Three-dimensional reconstructions of Hoxa1 -/- rhombencephalon revealed that it bears only 5 rhombomeric structures instead of the normal 7. A single maternal administration of a low dose of the vitamin A metabolite retinoic acid was sufficient to compensate the requirement for Hoxa1 function in Hoxa1-deficient mice.

Application Notes

Optimal dilution of the HOXA1 antibody should be determined by the researcher.

Immunogen

Amino acids 202-243 (AQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTE) were used as the immunogen for the HOXA1 antibody.

Storage

After reconstitution, the HOXA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all HOXA1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.