• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> HMGB2 Antibody

HMGB2 Antibody (R32439)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32439 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat liver and 2) human placenta lysate with HMGB2 antibody at 0.5ug/ml. Expected molecular weight ~24 kDa.
›
Western blot testing of 1) rat liver and 2) human placenta lysate with HMGB2 antibody at 0.5ug/ml. Expected molecular weight ~24 kDa.
IHC testing of FFPE human intestinal cancer tissue with HMGB2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
IHC testing of FFPE mouse intestine tissue with HMGB2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
IHC testing of FFPE rat spleen tissue with HMGB2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
IF/ICC staining of FFPE human U-2 OS cells with HMGB2 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human A431 cells with HMGB2 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMGB2 antibody.
Immunofluorescent staining of FFPE human MCF7 cells with HMGB2 antibody (green) and Alpha Tubulin antibody (red). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human Jurkat, 2) rat PC-12 and 3) mouse spleen lysate with HMGB2 antibody at 0.5ug/ml. Expected molecular weight ~24 kDa.
Immunofluorescent staining of FFPE rat intestine tissue with HMGB2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P26583
Localization Nuclear
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Immunofluorescence/Immunocytochemistry (FFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This HMGB2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Rat, Bovine, Pig

Description

High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

Application Notes

Optimal dilution of the HMGB2 antibody should be determined by the researcher.

Immunogen

Amino acids KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR were used as the immunogen for the HMGB2 antibody.

Storage

Prior to reconstitution, store at 4oC. After reconstitution, the HMGB2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all HMGB2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.