• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> HHEX Antibody / HEX / Hematopoietically expressed homeobox protein

HHEX Antibody / HEX / Hematopoietically expressed homeobox protein (R32186)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32186 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat liver, 2) mouse liver and 3) human HepG2 lysate with HHEX antibody. Routinely observed at 35~37 kDa (Ref 1), observed here at ~47 kDa.
Western blot testing of 1) rat liver, 2) mouse liver and 3) human HepG2 lysate with HHEX antibody. Routinely observed at 35~37 kDa (Ref 1), observed here at ~47 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q03014
Applications Western blot : 0.1-0.5ug/ml
Limitations This HHEX antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the HHEX gene. Homeobox genes are members of a family of transcription factors that regulate tissue development in many different organisms. Hromas et al. (1993) set out to identify homeobox genes that might play a role in hematopoiesis. And using somatic cell hybrid analysis, they mapped the HHEX gene to chromosome 10, where the HOX11 gene is located. Homeobox genes are involved in neoplastic transformation of both epithelial and hemopoietic tissues. The divergent homeobox gene HEX is expressed in the anterior visceral endoderm during early mouse development and in some adult tissues of endodermal origin, including liver and thyroid. D'Elia et al.’s findings suggested that regulation of HEX entry in the nucleus of thyrocytes may represent a critical step during human thyroid tumorigenesis.

Application Notes

Optimal dilution of the HHEX antibody should be determined by the researcher.

Immunogen

Amino acids NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ of human HHEX were used as the immunogen for the HHEX antibody.

Storage

After reconstitution, the HHEX antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Hex antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.