• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> GAL4 Antibody / Galectin-4

GAL4 Antibody / Galectin-4 (R32387)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32387 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) SW620 and 2) COLO320 cell lysate with GAL4 antibody. Expected molecular weight ~36 kDa.
›
Western blot testing of human 1) SW620 and 2) COLO320 cell lysate with GAL4 antibody. Expected molecular weight ~36 kDa.
IF/ICC staining of FFPE human A431 cells with GAL4 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human ThP1 cells with GAL4 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= GAL4 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P56470
Applications Western blot : 0.1-0.5ug/ml
Immunofluorescence/Immunocytochemistry (FFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This GAL4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.

Application Notes

Optimal dilution of the GAL4 antibody should be determined by the researcher.

Immunogen

Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.

Storage

After reconstitution, the GAL4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.