• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> GADD34 Antibody / PPP1R15A

GADD34 Antibody / PPP1R15A (RQ7101)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ7101 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) human HEL, 2) human RT4 and 3) human U-251 cell lysate with PPP1R15A antibody. Predicted molecular weight ~73 kDa, can be observed at up to ~110 kDa.
Western blot testing of 1) human HEL, 2) human RT4 and 3) human U-251 cell lysate with PPP1R15A antibody. Predicted molecular weight ~73 kDa, can be observed at up to ~110 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt O75807
Applications Western blot : 0.5-1ug/ml
Limitations This GADD34 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC, ICC/IF, FACS, ELISA (peptide)
    Reactivity : Human
  • Applications : WB, IHC-P, Direct ELISA
    Reactivity : Human, Rat
  • Applications : WB, FACS, Direct ELISA
    Reactivity : Mouse

Description

Protein phosphatase 1 regulatory subunit 15A also known as growth arrest and DNA damage-inducible protein GADD34 is a protein that in humans is encoded by the PPP1R15A gene.

Application Notes

Optimal dilution of the GADD34 antibody should be determined by the researcher.

Immunogen

Amino acids MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLR were used as the immunogen for the GADD34 antibody.

Storage

After reconstitution, the GADD34 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all PPP1R15A antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.