• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> FUS Antibody / TLS

FUS Antibody / TLS (R32864)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32864 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) human HepG2, 2) human K562 and 3) mouse NIH3T3 cell lysate with FUS antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa but routinely observed at up to ~75 kDa.
Western blot testing of 1) human HepG2, 2) human K562 and 3) mouse NIH3T3 cell lysate with FUS antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa but routinely observed at up to ~75 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P35637
Applications Western Blot : 0.5-1ug/ml
Limitations This FUS antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC, FACS, IF, ELISA
    Reactivity : Human, Mouse
    Pred. Reactivity : Bovine
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human, Mouse, Rat

Description

RNA-binding protein FUS/TLS (Fused in Sarcoma/Translocated in Sarcoma), also called 75 kDa DNA pairing protein, is a protein that in humans is encoded by the FUS gene. This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Application Notes

Optimal dilution of the FUS antibody should be determined by the researcher.

Immunogen

Amino acids DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT were used as the immunogen for the FUS antibody.

Storage

After reconstitution, the FUS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all FUS antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.