- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Flt3 ligand Antibody (R32117)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32117 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | P49771 |
| Applications | Western blot : 0.1-0.5ug/ml |
| Limitations | This Flt3 ligand antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
FLT3LG (FMS-Related Tyrosine Kinase 3 Ligand) also called FLT3 LIGAND, FL or FLT3L, is a protein which in humans is encoded by the FLT3LG gene. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts. Flt3 ligand (FL) is a hematopoietic four helical bundlecytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors. Lyman et al. (1993) found that Flt3 ligand stimulated proliferation of hematopoietic progenitor cells isolated from mouse fetal liver or adult mouse bone marrow. Hannum et al. (1994) concluded that FL enhances the response of stem and primitive progenitor cells to other growth factors to generate all myeloid lineages except erythroid cells. Assays of C-terminally truncated FL proteins confirmed that the N-terminal half conferred FL activity. Depletion of the Pi3k -Mtor negative regulator Pten facilitated Flt3l-driven DC development in culture.
Optimal dilution of the Flt3 ligand antibody should be determined by the researcher.
Amino acids AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK of human Flt3 ligand were used as the immunogen for the Flt3 ligand antibody.
After reconstitution, the Flt3 ligand antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz