• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> CSF1R Antibody / Macrophage Colony Stimulating Factor 1 Receptor [Discontinued, view alternative antibodies]

CSF1R Antibody / Macrophage Colony Stimulating Factor 1 Receptor [Discontinued, view alternative antibodies] (RQ4642)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4642 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Bulk quote request
Flow cytometry testing of human HL-60 cells with CSF1R antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CSF1R antibody.
Flow cytometry testing of human HL-60 cells with CSF1R antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CSF1R antibody.
Availability Discontinued
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P07333
Applications Flow Cytometry : 1-3ug/10^6 cells
Limitations This CSF1R antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

CSF1R (Colony stimulating factor 1 receptor),also known as M-CSFR and CD115, is a cell-surface protein encoded, in humans, by the CSF1R gene. The gene is located on long arm of chromosome 5 (5q32) on the Crick (minus) strand. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. The encoded protein is a single pass type I membrane protein and acts as the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. Both CSF1R, and its ligand colony stimulating factor 1 play an important role in the development of the mammary gland and may be involved in the process of mammary gland carcinogenesis.

Application Notes

Optimal dilution of the CSF1R antibody should be determined by the researcher.

Immunogen

Amino acids RPLELRDLLHFSSQVAQGMAFLASKNCIHRD were used as the immunogen for the CSF1R antibody.

Storage

After reconstitution, the CSF1R antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all CSF1R antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.