• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> CRH Antibody / Corticotropin Releasing Hormone [Discontinued, view alternative antibodies]

CRH Antibody / Corticotropin Releasing Hormone [Discontinued, view alternative antibodies] (R32669)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32669 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Bulk quote request
Western blot testing of 1) mouse NIH3T3 and 2) human MCF7 cell lysate with CRH antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
›
Western blot testing of 1) mouse NIH3T3 and 2) human MCF7 cell lysate with CRH antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
IHC testing of FFPE human intestinal cancer tissue with CRH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Availability Discontinued
Species Reactivity Human, Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P06850
Applications Western Blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This CRH antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Corticotropin-releasing hormone (CRH), also known as corticotropin-releasing factor (CRF) or corticoliberin is a peptide hormone and neurotransmitter involved in the stress response. In humans, it is encoded by the CRH gene. This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus, binds to corticotropin releasing hormone receptors and stimulates the release of adrenocorticotropic hormone from the pituitary gland. Marked reduction in this protein has been observed in association with Alzheimer's disease. Autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition.

Application Notes

Optimal dilution of the CRH antibody should be determined by the researcher.

Immunogen

Amino acids 162-194 (DLTFHLLREVLEMARAEQLAQQAHSNRKLMEII) from the human protein were used as the immunogen for the CRH antibody.

Storage

After reconstitution, the CRH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all CRH antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.