• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> CPT1B Antibody

CPT1B Antibody (R32293)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32293 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Immunofluorescent staining of FFPE mouse heart tissue with CPT1B antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
›
Immunofluorescent staining of FFPE mouse heart tissue with CPT1B antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE rat heart tissue with CPT1B antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
IHC testing of FFPE mouse skeletal muscle and CPT1B antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat heart and CPT1B antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of frozen mouse heart tissue with CPT1B antibody.
IHC testing of frozen rat heart tissue with CPT1B antibody.
Western blot testing of 1) rat heart, 2) rat skeletal muscle, 3) mouse heart, and 4) mouse skeletal muscle lysate wtih CPT1B antibody. Expected molecular weight ~88 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% BSA, 0.025% sodium azide
UniProt Q92523
Localization Cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Immunohistochemistry (Frozen) : 0.5-1ug/ml
Immunofluorescence : 5ug/ml
Limitations This CPT1B antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, IHC, ELISA
    Reactivity : Human
  • Applications : IHC, ELISA (peptide)
    Reactivity : Human

Description

CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

Application Notes

Optimal dilution of the CPT1B antibody should be determined by the researcher.

Immunogen

Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B were used as the immunogen for the CPT1B antibody.

Storage

After reconstitution, the CPT1B antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all CPT1B antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.