• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> CHRNA3 Antibody

CHRNA3 Antibody (RQ4415)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4415 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) MDA-MB-453, 3) Jurkat, 4) HepG2, 5) SK-OV-3, 6) PANC-1 and 7) mouse thymus lysate with CHRNA3 antibody at 0.5ug/ml. Predicted molecular weight ~57 kDa.
›
Western blot testing of human 1) HeLa, 2) MDA-MB-453, 3) Jurkat, 4) HepG2, 5) SK-OV-3, 6) PANC-1 and 7) mouse thymus lysate with CHRNA3 antibody at 0.5ug/ml. Predicted molecular weight ~57 kDa.
Flow cytometry testing of human U-251 MG cells with CHRNA3 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CHRNA3 antibody.
Flow cytometry testing of human U-87 MG cells with CHRNA3 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CHRNA3 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P32297
Applications Western blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This CHRNA3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt]

Application Notes

Optimal dilution of the CHRNA3 antibody should be determined by the researcher.

Immunogen

Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.

Storage

After reconstitution, the CHRNA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all CHRNA3 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.