• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Cdc20 Antibody

Cdc20 Antibody (R32832)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32832 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human HeLa cell lysate with Cdc20 antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa.
›
Western blot testing of human HeLa cell lysate with Cdc20 antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa.
IHC testing of FFPE human colon cancer tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human breast cancer tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse small intestine tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat small intestine tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Immunofluorescent staining of FFPE mouse NIH3T3 cells with Cdc20 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human U-2 OS cells with Cdc20 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cdc20 antibody.
Flow cytometry testing of human SiHa cells with Cdc20 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cdc20 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q12834
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Immunofluorescence : 2-4ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This Cdc20 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This gene's most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.

Application Notes

Optimal dilution of the Cdc20 antibody should be determined by the researcher.

Immunogen

Amino acids QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT were used as the immunogen for the Cdc20 antibody.

Storage

After reconstitution, the Cdc20 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Cdc20 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.