• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> CD47 Antibody / IAP

CD47 Antibody / IAP (R32830)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32830 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) MCF7, 2) SK-OV-3 and 3) PANC-1 cell lysate with CD47 antibody at 0.5ug/ml. Predicted molecular weight: 35~60 kDa depending on glycosylation level.
Western blot testing of human 1) MCF7, 2) SK-OV-3 and 3) PANC-1 cell lysate with CD47 antibody at 0.5ug/ml. Predicted molecular weight: 35~60 kDa depending on glycosylation level.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q08722
Applications Western Blot : 0.5-1ug/ml
Limitations This CD47 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Application Notes

Optimal dilution of the CD47 antibody should be determined by the researcher.

Immunogen

Amino acids KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT were used as the immunogen for the CD47 antibody.

Storage

After reconstitution, the CD47 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all CD47 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.