• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> CCR3 Antibody

CCR3 Antibody (RQ4331)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4331 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) Jurkat, 2) HepG2, 3) MCF7, 4) U-87 MG, 5) CCRF-CEM, 6) rat brain, 7) mouse brain and 8) mouse testis lysate wtih CCR3 antibody at 0.5ug/ml. Expected molecular weight: 40~55 kDa.
›
Western blot testing of human 1) Jurkat, 2) HepG2, 3) MCF7, 4) U-87 MG, 5) CCRF-CEM, 6) rat brain, 7) mouse brain and 8) mouse testis lysate wtih CCR3 antibody at 0.5ug/ml. Expected molecular weight: 40~55 kDa.
Flow cytometry testing of mouse RAW264.7 cells with CCR3 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CCR3 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P51677
Localization Cell membrane
Applications Western blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This CCR3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, ICC
    Reactivity : Human
  • Applications : WB, FACS, ELISA
    Reactivity : Human
    Pred. Reactivity : Primate

Description

C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.

Application Notes

Optimal dilution of the CCR3 antibody should be determined by the researcher.

Immunogen

Amino acids MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA were used as the immunogen for the CCR3 antibody.

Storage

After reconstitution, the CCR3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all CCR3 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.