• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> CCKBR Antibody

CCKBR Antibody (RQ4324)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4324 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) PANC-1, 2) U-87 MG, 3) COLO-320 and 4) SGC-7901 cell lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
›
Western blot testing of human 1) PANC-1, 2) U-87 MG, 3) COLO-320 and 4) SGC-7901 cell lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
Western blot testing of 1) rat brain, 2) rat stomach and 3) mouse brain lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
Flow cytometry testing of human LoVo cells with CCKBR antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CCKBR antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P32239
Localization Cell membrane
Applications Western blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This CCKBR antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, ELISA (peptide)
    Reactivity : Human, Mouse

Description

The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.

Application Notes

Optimal dilution of the CCKBR antibody should be determined by the researcher.

Immunogen

Amino acids PVYTVVQPVGPRVLQCVHRWPSARVRQTWS were used as the immunogen for the CCKBR antibody.

Storage

After reconstitution, the CCKBR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all CCKBR antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.