• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ATP2A1 Antibody

ATP2A1 Antibody (R30155)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R30155 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of ATP2A1 antibody and Lane 1: rat skeletal muscle; 2: mouse skeletal muscle; Predicted size: 110KD; Observed size: 110KD
›
Western blot testing of ATP2A1 antibody and Lane 1: rat skeletal muscle; 2: mouse skeletal muscle; Predicted size: 110KD; Observed size: 110KD
IHC-P: ATP2A1 antibody testing of rat skeletal muscle tissue
IHC-P: ATP2A1 antibody testing of mouse skeletal muscle tissue
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Gene ID 487
Applications Western blot : 0.5-1ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This ATP2A1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

Application Notes

The stated application concentrations are suggested starting amounts. Titration of the ATP2A1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Immunogen

An amino acid sequence from the N-terminus of human ATP2A1 (MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) was used as the immunogen for this ATP2A1 antibody.

Storage

After reconstitution, the ATP2A1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ATP2A1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.